Aji : 415 Unsupported Media Type

Aji.limo open link

Aji.limo Daily Stats
Daily Unique Visitors   Daily Unique Visitors 536,399
Daily Pageviews   Daily Pageviews 1,609,197
Daily  Revenue   Daily Revenue $ 4,827.59
Aji.limo Monthly Stats
Estimated Monthly Stats   Monthly Unique Visitors 15,839,860
Monthly Pageviews   Monthly Pageviews 47,519,587
Monthly  Revenue   Monthly Revenue $ 142,558.76
Aji.limo Yearly Stats
Yearly Unique Visitors   Yearly Unique Visitors 195,915,677
Yearly Pageviews   Yearly Pageviews 587,747,135
yearly  Revenue   Yearly Revenue $ 1,763,241.41

Aji.limo or simply erothots receives roughly 1,609,197 pageviews (page impressions) daily from it's 536,399 unique daily visitor. The creation date of aji.limo was not found. and it's hosted on the IP Address 104.21.87.7 in Toronto, Canada. It has an estimated worth of $ 9,642,750.31 and a global Alexa rank of 3,518,513.

Updated 3 months ago

Update Now!

Aji.limo Basic information

Domain name Aji.limo
Title

415 Unsupported Media Type

Keywords

Description

Aji.limo Location Stats

IP Address 104.21.87.7
Country Canada Canada
Region Ontario
City Toronto
Longitude -79.3832
Latitude 43.6532

Aji.limo Header

  Aji.limo DNS Records

  Aji.limo SSL Certificate

  Aji.limo WHOIS

TLD is not supported.
>>> Last update of WHOIS database: 2025-08-10T23:20:54Z <<<

Terms of Use: Access to WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the registry database. The data in this record is provided by Identity Digital or the Registry Operator for informational purposes only, and accuracy is not guaranteed. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Identity Digital except as reasonably necessary to register domain names or modify existing registrations. When using the Whois service, please consider the following: The Whois service is not a replacement for standard EPP commands to the SRS service. Whois is not considered authoritative for registered domain objects. The Whois service may be scheduled for downtime during production or OT&E maintenance periods. Queries to the Whois services are throttled. If too many queries are received from a single IP address within a specified time, the service will begin to reject further queries for a period of time to prevent disruption of Whois service access. Abuse of the Whois system through data mining is mitigated by detecting and limiting bulk query access from single sources. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Should you wish to contact the registrant, please refer to the Whois records available through the registrar URL listed above. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis for accessing the withheld data. Access to this data provided by Identity Digital can be requested by submitting a request via the form found at https://www.identity.digital/about/policies/whois-layered-access/. The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Identity Digital Inc. and Registry Operator reserve the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

  Typos of Aji.limo

www.ji.limowww.sji.limo
www.ai.limowww.qji.limo
www.aj.limowww.zji.limo
www.aaji.limowww.aju.limo
www.ajji.limowww.ajj.limo
www.ajii.limowww.ajk.limo
www.jai.limowww.ajo.limo
www.aij.limo

Recently Viewed Websites

WebsiteLast Visit
tortuna.com3 Sec ago
scoalaomega.ro3 Sec ago
10mejores.es6 Sec ago
premierpsychiatricservicesllc.weebly.com6 Sec ago
smnaji.ir7 Sec ago